Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RFC1 protein

This Human RFC1 protein spans the amino acid sequence from region 402-492aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activator 1 140KDA subunit

UniProt

P35251

Expression Region

402-492aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 402-492aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Strongylocentrotus purpuratus High mobility group protein 1 homolog (HMG1)
MBS1096405-01 0.02 mg (E-Coli)

Recombinant Strongylocentrotus purpuratus High mobility group protein 1 homolog (HMG1)

Sign In for Pricing
View Details
Recombinant Strongylocentrotus purpuratus High mobility group protein 1 homolog (HMG1)
MBS1096405-02 0.1 mg (E-Coli)

Recombinant Strongylocentrotus purpuratus High mobility group protein 1 homolog (HMG1)

Sign In for Pricing
View Details
Recombinant Strongylocentrotus purpuratus High mobility group protein 1 homolog (HMG1)
MBS1096405-03 0.02 mg (Yeast)

Recombinant Strongylocentrotus purpuratus High mobility group protein 1 homolog (HMG1)

Sign In for Pricing
View Details
Recombinant Strongylocentrotus purpuratus High mobility group protein 1 homolog (HMG1)
MBS1096405-04 0.1 mg (Yeast)

Recombinant Strongylocentrotus purpuratus High mobility group protein 1 homolog (HMG1)

Sign In for Pricing
View Details
Recombinant Strongylocentrotus purpuratus High mobility group protein 1 homolog (HMG1)
MBS1096405-05 0.02 mg (Baculovirus)

Recombinant Strongylocentrotus purpuratus High mobility group protein 1 homolog (HMG1)

Sign In for Pricing
View Details
Recombinant Strongylocentrotus purpuratus High mobility group protein 1 homolog (HMG1)
MBS1096405-06 0.02 mg (Mammalian-Cell)

Recombinant Strongylocentrotus purpuratus High mobility group protein 1 homolog (HMG1)

Sign In for Pricing
View Details