Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat GLP1R protein

This Rat GLP1R protein spans the amino acid sequence from region 22-135aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glpr

UniProt

P32301

Expression Region

22-135aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged Expression Region: 22-135aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CSF1 protein
orb605310-01 20 µg

Human CSF1 protein

Sign In for Pricing
View Details
Human CSF1 protein
orb605310-02 100 µg

Human CSF1 protein

Sign In for Pricing
View Details
Human CSF1 protein
orb605310-03 1 mg

Human CSF1 protein

Sign In for Pricing
View Details
Human TSPAN32 Protein Lysate
MBS8429225-01 0.02 mg

Human TSPAN32 Protein Lysate

Sign In for Pricing
View Details
Human TSPAN32 Protein Lysate
MBS8429225-02 5x 0.02 mg

Human TSPAN32 Protein Lysate

Sign In for Pricing
View Details
Human Collagen type IV alpha-3-binding protein (COL4A3BP) ELISA kit
CK-bio-11725-01 48 Tests

Human Collagen type IV alpha-3-binding protein (COL4A3BP) ELISA kit

Sign In for Pricing
View Details