Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse PRND protein

This Mouse PRND protein spans the amino acid sequence from region 27-155aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Prnd, Prion-like protein doppel, Doppelganger, Dpl, PrPLP

UniProt

Q9QUG3

Expression Region

27-155aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged Expression Region: 27-155aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL32 Recombinant Protein (Human)
RP019930 100 µg

MRPL32 Recombinant Protein (Human)

Sign In for Pricing
View Details
Rhox4c (NM_001039689) Mouse Tagged ORF Clone
MR221238 10 µg

Rhox4c (NM_001039689) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GluA1 Antibody, Clone N355/1: HRP
SMC-440D-HRP 100 µg

GluA1 Antibody, Clone N355/1: HRP

Sign In for Pricing
View Details
SOX15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2261408 1.0 µg DNA

SOX15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Donkey Cyclin G Associated Kinase (GAK) ELISA Kit
MBS9350947 Inquire

Donkey Cyclin G Associated Kinase (GAK) ELISA Kit

Sign In for Pricing
View Details
Recombinant Streptococcus equi subsp. zooepidemicus Prolipoprotein diacylglyceryl transferase (lgt)
MBS1100913 Inquire

Recombinant Streptococcus equi subsp. zooepidemicus Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details