Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse PRND protein

This Mouse PRND protein spans the amino acid sequence from region 27-155aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Prnd, Prion-like protein doppel, Doppelganger, Dpl, PrPLP

UniProt

Q9QUG3

Expression Region

27-155aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged Expression Region: 27-155aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse S1PR4 (Sphingosine 1 Phosphate Receptor 4) ELISA Kit
EM1341 96 Tests

Mouse S1PR4 (Sphingosine 1 Phosphate Receptor 4) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human NUAK1 shRNA (UAS) - Lentiviral human NUAK1 shRNA (UAS, iRFP) plasmid
GTR15094264 1 Vial

Lentiviral human NUAK1 shRNA (UAS) - Lentiviral human NUAK1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PHAP1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2403634 100 µL

PHAP1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
D15Ertd621e ORF Vector (Mouse) (pORF)
17574014 1.0 µg DNA

D15Ertd621e ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Tumor necrosis factor related apoptosis inducing ligand 3 ELISA kit
GTR10421313 96 Well

Rabbit Tumor necrosis factor related apoptosis inducing ligand 3 ELISA kit

Sign In for Pricing
View Details
Recombinant Beta vulgaris subsp. maritima CASP-like protein Ni6 (Ni6)
orb2919006-01 20 µg

Recombinant Beta vulgaris subsp. maritima CASP-like protein Ni6 (Ni6)

Sign In for Pricing
View Details