Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse PRND protein

This Mouse PRND protein spans the amino acid sequence from region 27-155aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Prnd, Prion-like protein doppel, Doppelganger, Dpl, PrPLP

UniProt

Q9QUG3

Expression Region

27-155aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged Expression Region: 27-155aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOC3 Rabbit Polyclonal Antibody (BF350)
orb2415765 100 µL

APOC3 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Mouse Monoclonal CD45 Antibody (HLe-1(2D1)) [DyLight 594]
NB100-2658DL594 0.1 mL

Mouse Monoclonal CD45 Antibody (HLe-1(2D1)) [DyLight 594]

Sign In for Pricing
View Details
LIMK1 Antibody
A40422-100UL 100 µL

LIMK1 Antibody

Sign In for Pricing
View Details
IGBP1P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
24306061 1.0 µg DNA

IGBP1P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MIR7053 Mouse MicroRNA Expression Plasmid (MI0022902)
SC402936 10 µg

MIR7053 Mouse MicroRNA Expression Plasmid (MI0022902)

Sign In for Pricing
View Details
AKAP7 Rabbit Polyclonal Antibody
orb576100 100 µL

AKAP7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details