Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat TGF beta Receptor 2 protein

This Rat TGF beta Receptor 2 protein spans the amino acid sequence from region 24-166aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TGF-beta type II receptor Transforming growth factor-beta receptor type II

UniProt

P38438

Expression Region

24-166aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 24-166aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

eIF-6 Recombinant Mouse Monoclonal Antibody [A6A2-R]
HA601294 100 µL

eIF-6 Recombinant Mouse Monoclonal Antibody [A6A2-R]

Sign In for Pricing
View Details
Human DLK1, C-His Tag (ECD)
HA210634-01 20 µg

Human DLK1, C-His Tag (ECD)

Sign In for Pricing
View Details
Human DLK1, C-His Tag (ECD)
HA210634-02 50 µg

Human DLK1, C-His Tag (ECD)

Sign In for Pricing
View Details
Human DLK1, C-His Tag (ECD)
HA210634-03 100 µg

Human DLK1, C-His Tag (ECD)

Sign In for Pricing
View Details
Muscle Specific Actin (MSA/953), CF740 conjugate, 0.1mg/mL
BNC740953-100 1x 100 µL

Muscle Specific Actin (MSA/953), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Auristatin F TFA Salt
TRC-A794100-1MG 1 mg

Auristatin F TFA Salt

Sign In for Pricing
View Details