Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat TGF beta Receptor 2 protein

This Rat TGF beta Receptor 2 protein spans the amino acid sequence from region 24-166aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TGF-beta type II receptor Transforming growth factor-beta receptor type II

UniProt

P38438

Expression Region

24-166aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 24-166aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF beta Receptor I Recombinant Rabbit monoclonal Antibody
HA723604 100 µL

TGF beta Receptor I Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human Angiotensinogen, C-His Tag
HA211165-01 20 µg

Human Angiotensinogen, C-His Tag

Sign In for Pricing
View Details
Human Angiotensinogen, C-His Tag
HA211165-02 50 µg

Human Angiotensinogen, C-His Tag

Sign In for Pricing
View Details
Human Angiotensinogen, C-His Tag
HA211165-03 100 µg

Human Angiotensinogen, C-His Tag

Sign In for Pricing
View Details
Rsad2 Mouse Gene Knockout Kit (CRISPR)
KN515154 1 Kit

Rsad2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), Biotin conjugate, 0.1mg/mL
BNCB2434-100 1x 100 µL

Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details