Rat TGF beta Receptor 2 protein
This Rat TGF beta Receptor 2 protein spans the amino acid sequence from region 24-166aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
TGF-beta type II receptor Transforming growth factor-beta receptor type II
UniProt
P38438
Expression Region
24-166aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Baculovirus
Origin
Rattus norvegicus (Rat)
Field of Research
Signal Transduction
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 24-166aaSequence Info: Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402318-100 1x 100 µL
ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2318), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Imidazo[5,1-b]thiazole-3-carboxylic Acid Hydrochloride](https://cdn.genprice.uk/products/572/3670596868366/imageurl/trc-i707850-1mg.webp)
TRC-I707850-1MG 1 mg
Imidazo[5,1-b]thiazole-3-carboxylic Acid Hydrochloride
Sign In for Pricing
View Details ![SAMSN1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7D12]](https://cdn.genprice.uk/products/937/68dd1b81061270361ea1eb4b/imageurl/ta808940bm.webp)
TA808940BM 100 µL
SAMSN1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7D12]
Sign In for Pricing
View Details 
![Heme Oxygenase 1 (HMOX1) Rabbit Monoclonal Antibody [Clone ID: R02-6C1]](https://cdn.genprice.uk/products/937/68dd1b5b061270361ea0fcf8/imageurl/ta384444.webp)
TA384444 100 µL
Heme Oxygenase 1 (HMOX1) Rabbit Monoclonal Antibody [Clone ID: R02-6C1]
Sign In for Pricing
View Details