Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PARK2 protein

This Human PARK2 protein spans the amino acid sequence from region 1-465aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parkin RBR E3 ubiquitin-protein ligase Parkinson juvenile disease protein 2

UniProt

O60260

Expression Region

1-465aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-465aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DIO2 shRNA (UAS) - Lentiviral human DIO2 shRNA (UAS, GFP) (100)
GTR15349032 1 Vial

Lentiviral human DIO2 shRNA (UAS) - Lentiviral human DIO2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
hsa-miR-378a-5p miRNA Inhibitor
MBS8292974-01 10 nmol

hsa-miR-378a-5p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-378a-5p miRNA Inhibitor
MBS8292974-02 20 nmol

hsa-miR-378a-5p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-378a-5p miRNA Inhibitor
MBS8292974-03 5x 20 nmol

hsa-miR-378a-5p miRNA Inhibitor

Sign In for Pricing
View Details
Recombinant Human CYP24A1 Protein - (Dry Ice)
H00001591-Q01-10ug 10 µg

Recombinant Human CYP24A1 Protein - (Dry Ice)

Sign In for Pricing
View Details
Cd177 3'UTR GFP Stable Cell Line
TU153455 1.0 mL

Cd177 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details