Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PARK2 protein

This Human PARK2 protein spans the amino acid sequence from region 1-465aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parkin RBR E3 ubiquitin-protein ligase Parkinson juvenile disease protein 2

UniProt

O60260

Expression Region

1-465aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-465aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ARPC4 Rabbit pAb
GB112985-100 100 μL

Anti-ARPC4 Rabbit pAb

Sign In for Pricing
View Details
TNPO3 Peptide
4597P 0.05 mg

TNPO3 Peptide

Sign In for Pricing
View Details
RGD1306595 Protein Vector (Rat) (pPB-C-His)
PV299294 500 ng

RGD1306595 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
NP220 shRNA (m) Lentiviral Particles
sc-150040-V 200 µL

NP220 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Polyclonal antibody-Canine Calcitonin receptor-stimulating pepti
PA-RA-07690 100 µg

Polyclonal antibody-Canine Calcitonin receptor-stimulating pepti

Sign In for Pricing
View Details
2-Bromo-5- (ethylsulfonyl) pyridine
415978-01 25 mg

2-Bromo-5- (ethylsulfonyl) pyridine

Sign In for Pricing
View Details