Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLP1R protein

This Human GLP1R protein spans the amino acid sequence from region 24-145aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GLP 1 R, GLP 1 receptor, GLP 1R, GLP, GLP-1 receptor, GLP-1-R, GLP-1R, GLP1R, GLP1R_HUMAN, Glucagon like peptide 1 receptor, Glucagon-like peptide 1 receptor, MGC138331, OTTHUMP00000016340

UniProt

P43220

Expression Region

24-145aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 24-145aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymidylate Synthase Antibody
orb1332290 100 µg

Thymidylate Synthase Antibody

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Probable cytosol aminopeptidase (pepA), partial
MBS1044541 Inquire

Recombinant Vibrio cholerae serotype O1 Probable cytosol aminopeptidase (pepA), partial

Sign In for Pricing
View Details
Olfr667 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4220303 1.0 µg DNA

Olfr667 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PKMYT1 Mouse Monoclonal Antibody [Clone ID: OTI2B4]
TA500839S 30 µL

PKMYT1 Mouse Monoclonal Antibody [Clone ID: OTI2B4]

Sign In for Pricing
View Details
PI14 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-9514R-BF750 100 µL

PI14 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
NHLH2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-11524R-PerCP-Cy5.5 100 µL

NHLH2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details