Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLP1R protein

This Human GLP1R protein spans the amino acid sequence from region 24-145aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GLP 1 R, GLP 1 receptor, GLP 1R, GLP, GLP-1 receptor, GLP-1-R, GLP-1R, GLP1R, GLP1R_HUMAN, Glucagon like peptide 1 receptor, Glucagon-like peptide 1 receptor, MGC138331, OTTHUMP00000016340

UniProt

P43220

Expression Region

24-145aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 24-145aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTRC (Chymotrypsin-C) BioAssayTM ELISA Kit (Human) discontinued
382543 96 Tests

CTRC (Chymotrypsin-C) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
ARMC10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
12407066 1.0 µg DNA

ARMC10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ETFA Antibody
E301336 100 µg - 200 µL

ETFA Antibody

Sign In for Pricing
View Details
CaiT Antibody
orb810627 2 mg

CaiT Antibody

Sign In for Pricing
View Details
Bovine hemopexin ELISA Kit
OM621666 96 Strip Well

Bovine hemopexin ELISA Kit

Sign In for Pricing
View Details
EPOR (Erythropoietin Receptor, EPO-R) (MaxLight 550)
MBS6416042-01 0.1 mL

EPOR (Erythropoietin Receptor, EPO-R) (MaxLight 550)

Sign In for Pricing
View Details