Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLP1R protein

This Human GLP1R protein spans the amino acid sequence from region 24-145aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GLP 1 R, GLP 1 receptor, GLP 1R, GLP, GLP-1 receptor, GLP-1-R, GLP-1R, GLP1R, GLP1R_HUMAN, Glucagon like peptide 1 receptor, Glucagon-like peptide 1 receptor, MGC138331, OTTHUMP00000016340

UniProt

P43220

Expression Region

24-145aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 24-145aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YJEFN3 AAV Vector (Human) (CMV)
50618101 1 µg

YJEFN3 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Anti periostin mouse monoclonal antibody
MBS157782-01 0.1 mg

Anti periostin mouse monoclonal antibody

Sign In for Pricing
View Details
Anti periostin mouse monoclonal antibody
MBS157782-02 5x 0.1 mg

Anti periostin mouse monoclonal antibody

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Defensin Alpha 3, Neutrophil Specific (DEFa3)
TRV-0024455-01 200 µL

Biotin-Linked Polyclonal Antibody to Defensin Alpha 3, Neutrophil Specific (DEFa3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Defensin Alpha 3, Neutrophil Specific (DEFa3)
TRV-0024455-02 1 mL

Biotin-Linked Polyclonal Antibody to Defensin Alpha 3, Neutrophil Specific (DEFa3)

Sign In for Pricing
View Details
ABCB4 (MDR3, PGY3, GBD1, MDR2, PFIC-3, P-Glycoprotein 3, Multidrug resistance protein 3, ATP-binding cassette sub-family B member 4, P-glycoprotein 3)
144607 100 µg

ABCB4 (MDR3, PGY3, GBD1, MDR2, PFIC-3, P-Glycoprotein 3, Multidrug resistance protein 3, ATP-binding cassette sub-family B member 4, P-glycoprotein 3)

Sign In for Pricing
View Details