Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate IL10 protein

This Primate IL10 protein spans the amino acid sequence from region 19-178aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytokine synthesis inhibitory factor

UniProt

P51496

Expression Region

19-178aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: C-terminal 10xHis-taggedExpression Region: 19-178aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig Creatine kinase B-type (CKB) ELISA Kit
MBS281224-01 48 Tests

Pig Creatine kinase B-type (CKB) ELISA Kit

Sign In for Pricing
View Details
Pig Creatine kinase B-type (CKB) ELISA Kit
MBS281224-02 96 Tests

Pig Creatine kinase B-type (CKB) ELISA Kit

Sign In for Pricing
View Details
Pig Creatine kinase B-type (CKB) ELISA Kit
MBS281224-03 5x 96 Tests

Pig Creatine kinase B-type (CKB) ELISA Kit

Sign In for Pricing
View Details
Pig Creatine kinase B-type (CKB) ELISA Kit
MBS281224-04 10x 96 Tests

Pig Creatine kinase B-type (CKB) ELISA Kit

Sign In for Pricing
View Details
Dynlt1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6991203 1.0 µg DNA

Dynlt1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
FluoSite™ Anti-CD16a Antibody, FITC-Labeled
101979-2 100 Tests

FluoSite™ Anti-CD16a Antibody, FITC-Labeled

Sign In for Pricing
View Details