Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse SMN1 protein

This Mouse SMN1 protein spans the amino acid sequence from region 1-288aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Smn

UniProt

P97801

Expression Region

1-288aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-288aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAMGSGGAGSEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETPDKPKGTARRKPAKKNKSQKKNATTPLKQWKVGDKCSAVWSEDGCIYPATITSIDFKRETCVVVYTGYGNREEQNLSDLLSPTCEVANSTEQNTQENESQVSTDDSEHSSRSLRSKAHSKSKAAPWTSFLPPPPPMPGSGLGPGKPGLKFNGPPPPPPLPPPPFLPCWMPPFPSGPPIIPPPPPISPDCLDDTDALGSMLISWYMSGYHTGYYMGFRQNKKEGKCSHTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Autoimmune Regulator ELISA Kit
MBS107516 Inquire

Pigeon Autoimmune Regulator ELISA Kit

Sign In for Pricing
View Details
Recombinant Citrobacter koseri Protein viaA (viaA)
MBS1141553-01 0.02 mg (E-Coli)

Recombinant Citrobacter koseri Protein viaA (viaA)

Sign In for Pricing
View Details
Recombinant Citrobacter koseri Protein viaA (viaA)
MBS1141553-02 0.02 mg (Yeast)

Recombinant Citrobacter koseri Protein viaA (viaA)

Sign In for Pricing
View Details
Recombinant Citrobacter koseri Protein viaA (viaA)
MBS1141553-03 0.1 mg (E-Coli)

Recombinant Citrobacter koseri Protein viaA (viaA)

Sign In for Pricing
View Details
Recombinant Citrobacter koseri Protein viaA (viaA)
MBS1141553-04 0.1 mg (Yeast)

Recombinant Citrobacter koseri Protein viaA (viaA)

Sign In for Pricing
View Details
Recombinant Citrobacter koseri Protein viaA (viaA)
MBS1141553-05 0.02 mg (Baculovirus)

Recombinant Citrobacter koseri Protein viaA (viaA)

Sign In for Pricing
View Details