Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse SMN1 protein

This Mouse SMN1 protein spans the amino acid sequence from region 1-288aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Smn

UniProt

P97801

Expression Region

1-288aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-288aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAMGSGGAGSEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETPDKPKGTARRKPAKKNKSQKKNATTPLKQWKVGDKCSAVWSEDGCIYPATITSIDFKRETCVVVYTGYGNREEQNLSDLLSPTCEVANSTEQNTQENESQVSTDDSEHSSRSLRSKAHSKSKAAPWTSFLPPPPPMPGSGLGPGKPGLKFNGPPPPPPLPPPPFLPCWMPPFPSGPPIIPPPPPISPDCLDDTDALGSMLISWYMSGYHTGYYMGFRQNKKEGKCSHTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nsun6 (NM_001165943) Mouse Tagged ORF Clone
MR215986 10 µg

Nsun6 (NM_001165943) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD39 (ENTPD1) (NM_001776) Human Recombinant Protein
E45H34949M5 20 µg

CD39 (ENTPD1) (NM_001776) Human Recombinant Protein

Sign In for Pricing
View Details
DPY30, 1-99aa, Human, His tag, E.coli
E53A01920 50 µg

DPY30, 1-99aa, Human, His tag, E.coli

Sign In for Pricing
View Details
NHSL1, ID (NHSL1, C6orf63, KIAA1357, NHS-like protein 1) (Azide free) (HRP) discontinued
038966-HRP 200 µL

NHSL1, ID (NHSL1, C6orf63, KIAA1357, NHS-like protein 1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Mouse Ehf (NM_007914) AAV Particle
MR224226A1V 250 µL

Mouse Ehf (NM_007914) AAV Particle

Sign In for Pricing
View Details
Lentiviral human TTC7A sgRNA gene knockout kit - Lentiviral human TTC7A sgRNA gene knockout kit (100)
GTR15392449 1 Vial

Lentiviral human TTC7A sgRNA gene knockout kit - Lentiviral human TTC7A sgRNA gene knockout kit (100)

Sign In for Pricing
View Details