Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect MRJP1 protein

This Insect MRJP1 protein spans the amino acid sequence from region 20-432aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

56-KDA protein 4

UniProt

O18330

Expression Region

20-432aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Apis mellifera (Honeybee)

Field of Research

Developmental Biology, Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged Expression Region: 20-432aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin Antibody (YA3183, Rabbit)
HY-P83438-01 10 µL

Prohibitin Antibody (YA3183, Rabbit)

Sign In for Pricing
View Details
Prohibitin Antibody (YA3183, Rabbit)
HY-P83438-02 50 μL

Prohibitin Antibody (YA3183, Rabbit)

Sign In for Pricing
View Details
Prohibitin Antibody (YA3183, Rabbit)
HY-P83438-03 100 µL

Prohibitin Antibody (YA3183, Rabbit)

Sign In for Pricing
View Details
Phospho-HER2/ErbB2 (Tyr1221/1222) Antibody [N18K6]
C18446-20uL 20 µL

Phospho-HER2/ErbB2 (Tyr1221/1222) Antibody [N18K6]

Sign In for Pricing
View Details
Recombinant Human CIBAR1
orb1784771-01 50 µg

Recombinant Human CIBAR1

Sign In for Pricing
View Details
Recombinant Human CIBAR1
orb1784771-02 100 µg

Recombinant Human CIBAR1

Sign In for Pricing
View Details