Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse ADAM12 protein

This Mouse ADAM12 protein spans the amino acid sequence from region 206-706aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Meltrin-alpha

UniProt

Q61824

Expression Region

206-706aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 206-706aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTACRGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIETNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-THAP1 Antibody (FITC)
STJ503247 100 µg

Anti-THAP1 Antibody (FITC)

Sign In for Pricing
View Details
IFN-α17 Lentiviral Activation Particles (h)
sc-416887-LAC 200 µL

IFN-α17 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
PPP1R8 Rabbit Polyclonal Antibody (FITC)
orb2125683 100 µL

PPP1R8 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Casein kinase Iγ1 shRNA Plasmid (m)
sc-38958-SH 20 µg

Casein kinase Iγ1 shRNA Plasmid (m)

Sign In for Pricing
View Details
TUBA1 (Tubulin, alpha 4a, FLJ30169, H2-ALPHA, TUBA1) (MaxLight 405) discontinued
253121-ML405 100 µL

TUBA1 (Tubulin, alpha 4a, FLJ30169, H2-ALPHA, TUBA1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
IL16 | IL-16 Rabbit pAb, FITC conjugated
orb3126421 100 µL

IL16 | IL-16 Rabbit pAb, FITC conjugated

Sign In for Pricing
View Details