Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse ADAM12 protein

This Mouse ADAM12 protein spans the amino acid sequence from region 206-706aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Meltrin-alpha

UniProt

Q61824

Expression Region

206-706aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 206-706aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTACRGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIETNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANKL antibody
MBS9406676-01 0.1 mL

RANKL antibody

Sign In for Pricing
View Details
RANKL antibody
MBS9406676-02 5x 0.1 mL

RANKL antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Angiotensin I Converting Enzyme (ACE)
TRV-0032151-01 20 µL

Monoclonal Antibody to Angiotensin I Converting Enzyme (ACE)

Sign In for Pricing
View Details
Monoclonal Antibody to Angiotensin I Converting Enzyme (ACE)
TRV-0032151-02 100 µL

Monoclonal Antibody to Angiotensin I Converting Enzyme (ACE)

Sign In for Pricing
View Details
Monoclonal Antibody to Angiotensin I Converting Enzyme (ACE)
TRV-0032151-03 200 µL

Monoclonal Antibody to Angiotensin I Converting Enzyme (ACE)

Sign In for Pricing
View Details
Monoclonal Antibody to Angiotensin I Converting Enzyme (ACE)
TRV-0032151-04 1 mL

Monoclonal Antibody to Angiotensin I Converting Enzyme (ACE)

Sign In for Pricing
View Details