What is the catalog number for Primate IL10 protein?

The catalog number for Primate IL10 protein is orb419287.

What sizes are available for Primate IL10 protein?

Primate IL10 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Primate IL10 protein come in?

Primate IL10 protein is available in 3 different pack sizes.

Is Primate IL10 protein in stock?

Primate IL10 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Primate IL10 protein

This Primate IL10 protein spans the amino acid sequence from region 19-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytokine synthesis inhibitory factor

UniProt

P51496

Expression Region

19-178aa

Tag

N-terminal 10xHis-tagged and C-terminal myc-tagged

Source

Baculovirus

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal myc-taggedExpression Region: 19-178aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN