Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPIFA2 protein

This Human BPIFA2 protein spans the amino acid sequence from region 19-249aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parotid secretory protein

UniProt

Q96DR5

Expression Region

19-249aa

Tag

Tag-Free

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 19-249aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CCDC89 shRNA (UAS) - Lentiviral human CCDC89 shRNA (UAS) (100)
GTR15311469 1 Vial

Lentiviral human CCDC89 shRNA (UAS) - Lentiviral human CCDC89 shRNA (UAS) (100)

Sign In for Pricing
View Details
Human OR7E24 knockout cell line
ABC-KH10900 1 Vial

Human OR7E24 knockout cell line

Sign In for Pricing
View Details
5,6,7,8,9,10-Hexahydro-cyclohepta[b]quinolin-11-one
sc-319143 500 mg

5,6,7,8,9,10-Hexahydro-cyclohepta[b]quinolin-11-one

Sign In for Pricing
View Details
Anti-ß Lactamase [Clone 8A5.A10] - 100 μg
15720-100μg 100 µg

Anti-ß Lactamase [Clone 8A5.A10] - 100 μg

Sign In for Pricing
View Details
Hsa-miR-3927-5p miRNA Antagomir
CIJ1935-01 10 nmol

Hsa-miR-3927-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-3927-5p miRNA Antagomir
CIJ1935-02 20 nmol

Hsa-miR-3927-5p miRNA Antagomir

Sign In for Pricing
View Details