Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPIFA2 protein

This Human BPIFA2 protein spans the amino acid sequence from region 19-249aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parotid secretory protein

UniProt

Q96DR5

Expression Region

19-249aa

Tag

Tag-Free

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 19-249aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PYCR2 activation kit by CRISPRa
GA109311 1 Kit

Human PYCR2 activation kit by CRISPRa

Sign In for Pricing
View Details
MSTO2P AAV siRNA Pooled Vector
30770161 1.0 µg

MSTO2P AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mus musculus papillomavirus type 1 E7 Rabbit Polyclonal Antibody (Fluoro594)
orb3086607 200 µL

Mus musculus papillomavirus type 1 E7 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
CTR1 Rabbit pAb
E47R10773 100 µL

CTR1 Rabbit pAb

Sign In for Pricing
View Details
ACAP2 Antibody
orb1247853 0.1 mg

ACAP2 Antibody

Sign In for Pricing
View Details
N-cyclopropyl-5-nitropyridin-2-amine
sc-338267 100 mg

N-cyclopropyl-5-nitropyridin-2-amine

Sign In for Pricing
View Details