Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial PBANKA_093100 protein

This Bacterial PBANKA_093100 protein spans the amino acid sequence from region 756-960aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A0Y9WQZ1

Expression Region

756-960aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Plasmodium berghei

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 756-960aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNIKTIFSSFTFYFFFFIFIYAFLLSIMHIFINYFFYIYLFVFNINIYISNIYTIIMTFASLIAIPFSGYIIDNIGSFLFLLLCSSFFILIAISGTIYSCVFNLRSEVIAFISFNLIGISESIIPTVIISQIPTHLCVKKNEDITAAFAIFELVSMLIVSVNNYIFGYFLINKEYLNGLYILFVFVILVISLIFLLIFTIYWKAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-100 1x 100 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PXR (NR1I2) activation kit by CRISPRa
GA105894 1 Kit

Human PXR (NR1I2) activation kit by CRISPRa

Sign In for Pricing
View Details
SKAP55 (SKAP1) (NM_003726) Human Over-expression Lysate
LC401226 20 µg

SKAP55 (SKAP1) (NM_003726) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ephb6 activation kit by CRISPRa
GA201266 1 Kit

Mouse Ephb6 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Nitroacenaphthene
TRC-N491790-25MG 25 mg

3-Nitroacenaphthene

Sign In for Pricing
View Details
SDCCAG10 (CWC27) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C8]
TA808677BM 100 µL

SDCCAG10 (CWC27) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C8]

Sign In for Pricing
View Details