Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial PBANKA_093100 protein

This Bacterial PBANKA_093100 protein spans the amino acid sequence from region 756-960aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A0Y9WQZ1

Expression Region

756-960aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Plasmodium berghei

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 756-960aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNIKTIFSSFTFYFFFFIFIYAFLLSIMHIFINYFFYIYLFVFNINIYISNIYTIIMTFASLIAIPFSGYIIDNIGSFLFLLLCSSFFILIAISGTIYSCVFNLRSEVIAFISFNLIGISESIIPTVIISQIPTHLCVKKNEDITAAFAIFELVSMLIVSVNNYIFGYFLINKEYLNGLYILFVFVILVISLIFLLIFTIYWKAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse SLAMF6/Ly108 Protein (His Tag)
PKSM040764 100 µg

Recombinant Mouse SLAMF6/Ly108 Protein (His Tag)

Sign In for Pricing
View Details
Rapsyn (RAPSN) (NM_032645) Human Over-expression Lysate
LC403186 20 µg

Rapsyn (RAPSN) (NM_032645) Human Over-expression Lysate

Sign In for Pricing
View Details
Cathepsin H Antibody
KC-3803-01 50 μL

Cathepsin H Antibody

Sign In for Pricing
View Details
Cathepsin H Antibody
KC-3803-02 100 µL

Cathepsin H Antibody

Sign In for Pricing
View Details
Cathepsin H Antibody
KC-3803-03 1 mL

Cathepsin H Antibody

Sign In for Pricing
View Details
Diethylene Glycol Diethyl Ether
TRC-D444335-5G 5 g

Diethylene Glycol Diethyl Ether

Sign In for Pricing
View Details