Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SFTPB protein

This Human SFTPB protein spans the amino acid sequence from region 201-279aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

18KDA pulmonary-surfactant protein 6KDA protein Pulmonary surfactant-associated proteolipid SPL (Phe)

UniProt

P07988

Expression Region

201-279aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 201-279aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB Antibody [C363.16A] (FITC)
98-799 0.5 mg

CD45RB Antibody [C363.16A] (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal Chymotrypsin C/CTRC Antibody [DyLight 755]
NBP2-99799IR 0.1 mL

Rabbit Polyclonal Chymotrypsin C/CTRC Antibody [DyLight 755]

Sign In for Pricing
View Details
Recombinant Burkholderia cenocepacia UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD), partial
MBS1199690 Inquire

Recombinant Burkholderia cenocepacia UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD), partial

Sign In for Pricing
View Details
OOCA01058-25T - Human MAP1S Primer Pair 1
OOCA01058-25T 25 Tests

OOCA01058-25T - Human MAP1S Primer Pair 1

Sign In for Pricing
View Details
MTMR9 Antibody [APR05807G]
APR05807G-01 50 µL

MTMR9 Antibody [APR05807G]

Sign In for Pricing
View Details
MTMR9 Antibody [APR05807G]
APR05807G-02 100 µL

MTMR9 Antibody [APR05807G]

Sign In for Pricing
View Details