Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SFTPB protein

This Human SFTPB protein spans the amino acid sequence from region 201-279aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

18KDA pulmonary-surfactant protein 6KDA protein Pulmonary surfactant-associated proteolipid SPL (Phe)

UniProt

P07988

Expression Region

201-279aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 201-279aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-{Methyl[2- (methylamino) ethyl]amino}ethan-1-ol dihydrochloride
PED67281-01 50 mg

2-{Methyl[2- (methylamino) ethyl]amino}ethan-1-ol dihydrochloride

Sign In for Pricing
View Details
2-{Methyl[2- (methylamino) ethyl]amino}ethan-1-ol dihydrochloride
PED67281-02 0.5 g

2-{Methyl[2- (methylamino) ethyl]amino}ethan-1-ol dihydrochloride

Sign In for Pricing
View Details
DMEM (4.5g/l Glucose) with L-Gln and HEPES, without Sodium Pyruvate, liquid
08457-55 500 mL

DMEM (4.5g/l Glucose) with L-Gln and HEPES, without Sodium Pyruvate, liquid

Sign In for Pricing
View Details
Kif20a ORF Vector (Mouse) (pORF)
ORF048562 1.0 µg DNA

Kif20a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rat Ubiquitin like modifier activating enzyme 1 ELISA Kit
MBS7276050-01 48 Well

Rat Ubiquitin like modifier activating enzyme 1 ELISA Kit

Sign In for Pricing
View Details
Rat Ubiquitin like modifier activating enzyme 1 ELISA Kit
MBS7276050-02 96 Well

Rat Ubiquitin like modifier activating enzyme 1 ELISA Kit

Sign In for Pricing
View Details