Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse P2RX4 protein

This Mouse P2RX4 protein spans the amino acid sequence from region 55-338aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP receptor Purinergic receptor

UniProt

Q9JJX6

Expression Region

55-338aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 55-338aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDKTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVPTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTDPFCPIFRLGQIVADAGHSFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-CMV-SUCLG2-3xHA-EGFP-Puro Plasmid
PVT82214 2 µg

PLV3-CMV-SUCLG2-3xHA-EGFP-Puro Plasmid

Sign In for Pricing
View Details
Human RALBP1 Knockout HEK293T cell line
GTR15402628 1 Vial

Human RALBP1 Knockout HEK293T cell line

Sign In for Pricing
View Details
9-[3,4-dihydroxy-5- (methoxymethyl) oxolan-2-yl]-6,9-dihydro-1H-purin-6-one
orb3171306-01 1 mg

9-[3,4-dihydroxy-5- (methoxymethyl) oxolan-2-yl]-6,9-dihydro-1H-purin-6-one

Sign In for Pricing
View Details
9-[3,4-dihydroxy-5- (methoxymethyl) oxolan-2-yl]-6,9-dihydro-1H-purin-6-one
orb3171306-02 2 mg

9-[3,4-dihydroxy-5- (methoxymethyl) oxolan-2-yl]-6,9-dihydro-1H-purin-6-one

Sign In for Pricing
View Details
9-[3,4-dihydroxy-5- (methoxymethyl) oxolan-2-yl]-6,9-dihydro-1H-purin-6-one
orb3171306-03 3 mg

9-[3,4-dihydroxy-5- (methoxymethyl) oxolan-2-yl]-6,9-dihydro-1H-purin-6-one

Sign In for Pricing
View Details
9-[3,4-dihydroxy-5- (methoxymethyl) oxolan-2-yl]-6,9-dihydro-1H-purin-6-one
orb3171306-04 4 mg

9-[3,4-dihydroxy-5- (methoxymethyl) oxolan-2-yl]-6,9-dihydro-1H-purin-6-one

Sign In for Pricing
View Details