Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human REXO4 protein

This Human REXO4 protein spans the amino acid sequence from region 1-422aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Exonuclease XPMC2 Prevents mitotic catastrophe 2 protein homolog Short name, hPMC2

UniProt

Q9GZR2

Expression Region

1-422aa

Tag

N-terminal 6xHis-B2M-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 1-422aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGKAKVPASKRAPSSPVAKPGPVKTLTRKKNKKKKRFWKSKAREVSKKPASGPGAVVRPPKAPEDFSQNWKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIEHKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEMVGVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLKGRILVGHALHNDLKVLFLDHPKKKIRDTQKYKPFKSQVKSGRPSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPLLTAPDHCSDDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTX2 Rabbit pAb, AP conjugated
orb2844786 100 µL

OTX2 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
ABCF2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-12441R-BF647 100 µL

ABCF2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Porcine Complement Component 4b (C4b) ELISA Kit
MBS263836-01 48 Well

Porcine Complement Component 4b (C4b) ELISA Kit

Sign In for Pricing
View Details
Porcine Complement Component 4b (C4b) ELISA Kit
MBS263836-02 96 Well

Porcine Complement Component 4b (C4b) ELISA Kit

Sign In for Pricing
View Details
Porcine Complement Component 4b (C4b) ELISA Kit
MBS263836-03 5x 96 Well

Porcine Complement Component 4b (C4b) ELISA Kit

Sign In for Pricing
View Details
Porcine Complement Component 4b (C4b) ELISA Kit
MBS263836-04 10x 96 Well

Porcine Complement Component 4b (C4b) ELISA Kit

Sign In for Pricing
View Details