Viral GPC protein
This Viral GPC protein spans the amino acid sequence from region 10-90aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
GPC, GP-C, Segment, SPre-glycoprotein polyprotein GP complex, Pre-GP-C) [Cleaved into, Stable signal peptide, SSP), Glycoprotein G1, GP1), Glycoprotein G2, GP2) ]
UniProt
P09991
Expression Region
10-90aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
In vitro E.coli expression system
Origin
Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV)
Field of Research
Infectious Disease & Virology; Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
24.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 10-90aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ALPHIIDEVINIVIIVLIVITGIKAVYNFATCGIFALISFLLLAGRSCGMYGLKGPDIYKGVYQFKSVEFDMSHLNLTMPN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C7857-03 100 µg
Connexin 43 (Cx43, Gap Junction Alpha 1 Protein, CxA-1)
Sign In for Pricing
View Details 
213413-01 20 µL
SLC25A15 (Solute Carrier Family 25 Member 15, HHH, Ornithine Transporter 1, ORC1, ORNT1, D13S327) discontinued
Sign In for Pricing
View Details 213413-02 100 µL
SLC25A15 (Solute Carrier Family 25 Member 15, HHH, Ornithine Transporter 1, ORC1, ORNT1, D13S327) discontinued
Sign In for Pricing
View Details MBS1285790-01 0.02 mg (E-Coli)
Recombinant Rhizobium meliloti 2-aminoethylphosphonate--pyruvate transaminase (phnW)
Sign In for Pricing
View Details