Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ST6GAL1 protein

This Human ST6GAL1 protein spans the amino acid sequence from region 1-406aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell antigen CD75 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1 ST6Gal I

UniProt

P15907

Expression Region

1-406aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-406aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDH1 Chemi-Luminescent ELISA Kit (Human)
OKCD03571-96W 96 Well

IDH1 Chemi-Luminescent ELISA Kit (Human)

Sign In for Pricing
View Details
Desmocollin 2 + 3 Rabbit Polyclonal Antibody (BF750)
orb1610516 100 µL

Desmocollin 2 + 3 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Mouse Polyclonal IP3KC Antibody
H00080271-B01P 0.05 mg

Mouse Polyclonal IP3KC Antibody

Sign In for Pricing
View Details
Gpr141 3'UTR Luciferase Stable Cell Line
TU108982 1.0 mL

Gpr141 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TAAR9 (Trace Amine-Associated Receptor 9)
493288 100 µL

TAAR9 (Trace Amine-Associated Receptor 9)

Sign In for Pricing
View Details
(αS, βR) -β- (2,4-Difluorophenyl) -β-hydroxy-α-methyl-1H-1,2,4-triazole-1-butanenitrile
009584 2.5 mg

(αS, βR) -β- (2,4-Difluorophenyl) -β-hydroxy-α-methyl-1H-1,2,4-triazole-1-butanenitrile

Sign In for Pricing
View Details