Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ST6GAL1 protein

This Human ST6GAL1 protein spans the amino acid sequence from region 1-406aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell antigen CD75 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1 ST6Gal I

UniProt

P15907

Expression Region

1-406aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-406aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rfx2 Antibody
orb861002 2 mg

Rfx2 Antibody

Sign In for Pricing
View Details
MAGEA4 Peptide - middle region
orb2001599 100 µg

MAGEA4 Peptide - middle region

Sign In for Pricing
View Details
Angiopoietin-Related protein 4 (ANGPTL4) Human ELISA Kit
B4894 96 Tests

Angiopoietin-Related protein 4 (ANGPTL4) Human ELISA Kit

Sign In for Pricing
View Details
Coproporphyrinogen Oxidase discontinued
508248 100 µg

Coproporphyrinogen Oxidase discontinued

Sign In for Pricing
View Details
Z-D-Asn-OH
5-07167 25 g

Z-D-Asn-OH

Sign In for Pricing
View Details
FGFR1OP2 siRNA (Mouse)
MBS8210924-01 15 nmol

FGFR1OP2 siRNA (Mouse)

Sign In for Pricing
View Details