Human ADIPOR1 protein
This Human ADIPOR1 protein spans the amino acid sequence from region 1-375aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Progestin and adipoQ receptor family member I
UniProt
Q96A54
Expression Region
1-375aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
In vitro E.coli expression system
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
62.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-375aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
124311-ML405 100 µL
CANT1 (Putative NF-kappa-B-activating Protein 107, Putative MAPK-activating Protein PM09, Apyrase Homolog, Soluble Calcium-activated Nucleotidase 1, SCAN-1, SHAPY) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
GTR15256193 1 Vial
Lentiviral mouse Krtap4-2 shRNA (UAS) - Lentiviral mouse Krtap4-2 shRNA (UAS) (25)
Sign In for Pricing
View Details RP1062-Dylight488 100 µg
Anti-Hepatocyte growth factor HGF Antibody Picoband® (Dylight488 Conjugate)
Sign In for Pricing
View Details