Human ADIPOR1 protein
This Human ADIPOR1 protein spans the amino acid sequence from region 1-375aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Progestin and adipoQ receptor family member I
UniProt
Q96A54
Expression Region
1-375aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
In vitro E.coli expression system
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
62.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-375aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2931844-01 20 µg
Recombinant Aquifex aeolicus Biopolymer transport protein exbB (exbB)
Sign In for Pricing
View Details orb2931844-02 100 µg
Recombinant Aquifex aeolicus Biopolymer transport protein exbB (exbB)
Sign In for Pricing
View Details 
W2997-03-ML650 100 µL
WNK2 (Serine/threonine-protein Kinase WNK2, Protein Kinase With No Lysine 2, Protein Kinase Lysine-deficient 2, Serologically Defined Colon Cancer Antigen 43, Antigen NY-CO-43, KIAA1760, PRKWNK2, SDCCAG43) (Azide Free) (MaxLight 650)
Sign In for Pricing
View Details 
MBS7213012-01 48 Well
Rat COP9 signalosome complex subunit 1 (GPS1) ELISA Kit
Sign In for Pricing
View Details MBS7213012-02 96 Well
Rat COP9 signalosome complex subunit 1 (GPS1) ELISA Kit
Sign In for Pricing
View Details