Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADIPOR1 protein

This Human ADIPOR1 protein spans the amino acid sequence from region 1-375aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Progestin and adipoQ receptor family member I

UniProt

Q96A54

Expression Region

1-375aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-375aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 27A1 Antibody, mAb, Rabbit
A04855-50 50 µL

Cytochrome P450 27A1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Anti-Claudin 5/CLDN5 Antibody-iFluor647 Conjugate
A03260-3-iFluor647 100 µg

Anti-Claudin 5/CLDN5 Antibody-iFluor647 Conjugate

Sign In for Pricing
View Details
Graviola Extract
C02425 5 mg

Graviola Extract

Sign In for Pricing
View Details
2-Phenylacrylic acid
FP142394-01 0.025 kg

2-Phenylacrylic acid

Sign In for Pricing
View Details
2-Phenylacrylic acid
FP142394-02 0.05 kg

2-Phenylacrylic acid

Sign In for Pricing
View Details
2-Phenylacrylic acid
FP142394-03 0.1 Kg

2-Phenylacrylic acid

Sign In for Pricing
View Details