Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PERP protein

This Human PERP protein spans the amino acid sequence from region 1-193aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Keratinocyte-associated protein 1

UniProt

Q96FX8

Expression Region

1-193aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-193aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLFN14 Knockout HEK293T cell line
GTR15408182 1 Vial

Human SLFN14 Knockout HEK293T cell line

Sign In for Pricing
View Details
Methyl 3-chloro-4-fluoro-5-methylbenzoate
PC1011660-01 250 mg

Methyl 3-chloro-4-fluoro-5-methylbenzoate

Sign In for Pricing
View Details
Methyl 3-chloro-4-fluoro-5-methylbenzoate
PC1011660-02 500 mg

Methyl 3-chloro-4-fluoro-5-methylbenzoate

Sign In for Pricing
View Details
Methyl 3-chloro-4-fluoro-5-methylbenzoate
PC1011660-03 1 g

Methyl 3-chloro-4-fluoro-5-methylbenzoate

Sign In for Pricing
View Details
SAPS1 Rabbit Polyclonal Antibody (HRP)
orb476169 100 µL

SAPS1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ECE2 Antibody
orb252075 100 µL

ECE2 Antibody

Sign In for Pricing
View Details