Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PERP protein

This Human PERP protein spans the amino acid sequence from region 1-193aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Keratinocyte-associated protein 1

UniProt

Q96FX8

Expression Region

1-193aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-193aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cacng2 sgRNA CRISPR Lentivector set (Rat)
K7061801 3x 1.0 µg

Cacng2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
RFNG Protein Vector (Rat) (pPM-C-His)
PV298897 500 ng

RFNG Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Adenosine triphosphate
591196 30.0mg

Adenosine triphosphate

Sign In for Pricing
View Details
Methyl 2-[3- (trifluoromethyl) phenyl]-3-pyridinecarboxylate
PC1009985-01 250 mg

Methyl 2-[3- (trifluoromethyl) phenyl]-3-pyridinecarboxylate

Sign In for Pricing
View Details
Methyl 2-[3- (trifluoromethyl) phenyl]-3-pyridinecarboxylate
PC1009985-02 1 g

Methyl 2-[3- (trifluoromethyl) phenyl]-3-pyridinecarboxylate

Sign In for Pricing
View Details
Methyl 2-[3- (trifluoromethyl) phenyl]-3-pyridinecarboxylate
PC1009985-03 5 g

Methyl 2-[3- (trifluoromethyl) phenyl]-3-pyridinecarboxylate

Sign In for Pricing
View Details