Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PRLR protein

This Human PRLR protein spans the amino acid sequence from region 25-622aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AI987712, CLONE SPM213, CPRLP, Delta 4-delta 7/11 truncated prolactin receptor , Delta 4-SF1b truncated prolactin receptor , HPRL, hPRL receptor, hPRLrI, Lactogen receptor, MFAB, MGC105486, OPR, OTTHUMP00000115998 , Pr-1, Pr-3, PRL R, PRL-R, PRLR, Prlr-rs1, PRLR_HUMAN, Prolactin receptor a, Prolactin receptor, Prolactin receptor delta 7/11 , RATPRLR, Secreted prolactin binding protein , Truncated testis-specific box 1-C prolactin receptor , wu, fj65c07

UniProt

P16471

Expression Region

25-622aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

71.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 25-622aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC3 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-12034R-BF647-01 20 µL

ZDHHC3 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
ZDHHC3 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-12034R-BF647-02 100 µL

ZDHHC3 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
3-Fluoro-2-methoxybenzoic acid
425542-01 100 mg

3-Fluoro-2-methoxybenzoic acid

Sign In for Pricing
View Details
3-Fluoro-2-methoxybenzoic acid
425542-02 250 mg

3-Fluoro-2-methoxybenzoic acid

Sign In for Pricing
View Details
DIABLO antibody
20R-1288 100 µL

DIABLO antibody

Sign In for Pricing
View Details
Nfkbiz Rat shRNA Plasmid (Locus ID 304005)
TL705667 1 Kit

Nfkbiz Rat shRNA Plasmid (Locus ID 304005)

Sign In for Pricing
View Details