Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADTRP protein

This Human ADTRP protein spans the amino acid sequence from region 1-230aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C6orf105

UniProt

Q96IZ2

Expression Region

1-230aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-230aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAH Polyclonal Antibody
A72417-050 50 µL

FAH Polyclonal Antibody

Sign In for Pricing
View Details
Micro L-galactose-1,4-lactone dehydrogenase (Gal LDH) Assay Kit
OM625975 100 Tests

Micro L-galactose-1,4-lactone dehydrogenase (Gal LDH) Assay Kit

Sign In for Pricing
View Details
Porcine Myelin Associated Glycoprotein Antibody (MAG Ab) ELISA Kit
EIA06005p 1 Kit

Porcine Myelin Associated Glycoprotein Antibody (MAG Ab) ELISA Kit

Sign In for Pricing
View Details
RASGRF1 Antibody (S929) Blocking Peptide
MBS9227019-01 0.5 mg

RASGRF1 Antibody (S929) Blocking Peptide

Sign In for Pricing
View Details
RASGRF1 Antibody (S929) Blocking Peptide
MBS9227019-02 5x 0.5 mg

RASGRF1 Antibody (S929) Blocking Peptide

Sign In for Pricing
View Details
C10orf12 Rabbit Polyclonal Antibody (Biotin)
orb2105230 100 µL

C10orf12 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details