Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish L-rhamnose-binding lectin CSL3 protein

This Fish L-rhamnose-binding lectin CSL3 protein spans the amino acid sequence from region 1-195aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

L-rhamnose-binding lectin CSL3

UniProt

P86179

Expression Region

1-195aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Oncorhynchus keta (Chum salmon) (Salmo keta)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 1-195aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AISITCEGSDALLQCDGAKIHIKRANYGRRQHDVCSIGRPDNQLTDTNCLSQSSTSKMAERCGGKSECIVPASNFVFGDPCVGTYKYLDTKYSCVQQQETISSIICEGSDSQLLCDRGEIRIQRANYGRRQHDVCSIGRPHQQLKNTNCLSQSTTSKMAERCDGKRQCIVSVSNSVFGDPCVGTYKYLDVAYTCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gngt2 siRNA Oligos set (Rat)
22334176 3x 5 nmol

Gngt2 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
NRP2 Protein (C-His, Human)
P527208 100 µg

NRP2 Protein (C-His, Human)

Sign In for Pricing
View Details
RN5S451 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV745488 1.0 µg DNA

RN5S451 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
TMEM156 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV658049 1.0 µg DNA

TMEM156 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
YKL-5-124 TFA
MBS5754140 Inquire

YKL-5-124 TFA

Sign In for Pricing
View Details
ASIC4 (E-5) : m-IgGκ BP-HRP Bundle
sc-536332 1 Kit

ASIC4 (E-5) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details