Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human STATH protein

This Human STATH protein spans the amino acid sequence from region 20-62aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

STAT_HUMAN, STATH, Statherin, Statherin precursor , STR

UniProt

P02808

Expression Region

20-62aa

Tag

N-terminal 10xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-taggedExpression Region: 20-62aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
MBS1604244-01 48 Well

Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Sign In for Pricing
View Details
Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
MBS1604244-02 96 Well

Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Sign In for Pricing
View Details
Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
MBS1604244-03 5x 96 Well

Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Sign In for Pricing
View Details
Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
MBS1604244-04 10x 96 Well

Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Sign In for Pricing
View Details
1- (4-Isopropylpyridin-2-yl) ethanone
OR1045927-01 100 mg

1- (4-Isopropylpyridin-2-yl) ethanone

Sign In for Pricing
View Details
1- (4-Isopropylpyridin-2-yl) ethanone
OR1045927-02 250 mg

1- (4-Isopropylpyridin-2-yl) ethanone

Sign In for Pricing
View Details