Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human STATH protein

This Human STATH protein spans the amino acid sequence from region 20-62aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

STAT_HUMAN, STATH, Statherin, Statherin precursor , STR

UniProt

P02808

Expression Region

20-62aa

Tag

N-terminal 10xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-taggedExpression Region: 20-62aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATIC Mouse Monoclonal Antibody
E10G20565 100 µL

ATIC Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Runx3 Mouse qPCR Primer Pair (NM_019732)
MP214930 200 Reactions

Runx3 Mouse qPCR Primer Pair (NM_019732)

Sign In for Pricing
View Details
SCN-10-C AB Labels
133112 Pack of 300 Piece(s)

SCN-10-C AB Labels

Sign In for Pricing
View Details
Mouse Monoclonal CCR5 Antibody (CTC5R) [FITC]
FAB1802RF 0.1 mL

Mouse Monoclonal CCR5 Antibody (CTC5R) [FITC]

Sign In for Pricing
View Details
RNF112 Antibody
OACD01939-1ML 1 mL

RNF112 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal 4-1BB/TNFRSF9/CD137 Antibody (4B4-1-1) [DyLight 594]
NBP3-12028DL594 0.1 mL

Mouse Monoclonal 4-1BB/TNFRSF9/CD137 Antibody (4B4-1-1) [DyLight 594]

Sign In for Pricing
View Details