What is the catalog number for E. coli ELTA protein?

The catalog number for E. coli ELTA protein is orb419220.

What sizes are available for E. coli ELTA protein?

E. coli ELTA protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does E. coli ELTA protein come in?

E. coli ELTA protein is available in 3 different pack sizes.

Is E. coli ELTA protein in stock?

E. coli ELTA protein is currently made to order / not held in immediate stock. Contact us for lead time.

E. coli ELTA protein

This E. coli ELTA protein spans the amino acid sequence from region 19-258aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LT-A, porcine LTP-A

UniProt

P06717

Expression Region

19-258aa

Tag

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 19-258aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL