Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TTN protein

This Human TTN protein spans the amino acid sequence from region 14257-14543aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Connectin Rhabdomyosarcoma antigen MU-RMS-40.14

UniProt

Q8WZ42

Expression Region

14257-14543aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 14257-14543aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Ms4a4a antibody
STJ11100290 100 µl

Anti-Ms4a4a antibody

Sign In for Pricing
View Details
Mmu-miR-505-3p miRNA Agomir
orb1918649-01 5 nmol

Mmu-miR-505-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-505-3p miRNA Agomir
orb1918649-02 10 nmol

Mmu-miR-505-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-505-3p miRNA Agomir
orb1918649-03 20 nmol

Mmu-miR-505-3p miRNA Agomir

Sign In for Pricing
View Details
Recombinant Enterobacter sp. 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)
MBS1151335-01 0.02 mg (E-Coli)

Recombinant Enterobacter sp. 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)

Sign In for Pricing
View Details
Recombinant Enterobacter sp. 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)
MBS1151335-02 0.02 mg (Yeast)

Recombinant Enterobacter sp. 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)

Sign In for Pricing
View Details