Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC34A2 protein

This Human SLC34A2 protein spans the amino acid sequence from region 574-689aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Na (+) -dependent phosphate cotransporter 2B NaPi3b Sodium/phosphate cotransporter 2B

UniProt

O95436

Expression Region

574-689aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 574-689aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRG1 (FSHD Region Gene 1 Protein, FRG1A, FSG1, Protein FRG1) (MaxLight 650)
126978-ML650 100 µL

FRG1 (FSHD Region Gene 1 Protein, FRG1A, FSG1, Protein FRG1) (MaxLight 650)

Sign In for Pricing
View Details
PAGE5 Antibody (C-term)
MBS9210102-01 0.08 mL

PAGE5 Antibody (C-term)

Sign In for Pricing
View Details
PAGE5 Antibody (C-term)
MBS9210102-02 0.4 mL

PAGE5 Antibody (C-term)

Sign In for Pricing
View Details
PAGE5 Antibody (C-term)
MBS9210102-03 5x 0.4 mL

PAGE5 Antibody (C-term)

Sign In for Pricing
View Details
Lentiviral mouse 9930111J21Rik1 shRNA (UAS) - Lentiviral mouse 9930111J21Rik1 shRNA (UAS) (100)
GTR15181290 1 Vial

Lentiviral mouse 9930111J21Rik1 shRNA (UAS) - Lentiviral mouse 9930111J21Rik1 shRNA (UAS) (100)

Sign In for Pricing
View Details
NFkB p100 / p52 Rabbit Polyclonal Antibody
orb1544836-01 50 μL

NFkB p100 / p52 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details