Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC34A2 protein

This Human SLC34A2 protein spans the amino acid sequence from region 574-689aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Na (+) -dependent phosphate cotransporter 2B NaPi3b Sodium/phosphate cotransporter 2B

UniProt

O95436

Expression Region

574-689aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 574-689aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH5 (NM_002441) Human Over-expression Lysate
LS004439-20ug 20 µg

MSH5 (NM_002441) Human Over-expression Lysate

Sign In for Pricing
View Details
OR10AF1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV772495 1.0 µg DNA

OR10AF1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
RNF186 Lentiviral Activation Particles (h2)
sc-408416-LAC-2 200 µL

RNF186 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Mouse Defa39 qPCR Primer Pair
QM73066S 200 Tests

Mouse Defa39 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Ribonucleoside-diphosphate reductase large subunit (RNR1), partial
MBS1399868 Inquire

Recombinant Acanthamoeba polyphaga mimivirus Ribonucleoside-diphosphate reductase large subunit (RNR1), partial

Sign In for Pricing
View Details
AP2M1 Antibody - C-terminal region
OAAB10967-400UL 400 µL

AP2M1 Antibody - C-terminal region

Sign In for Pricing
View Details