Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC34A2 protein

This Human SLC34A2 protein spans the amino acid sequence from region 574-689aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Na (+) -dependent phosphate cotransporter 2B NaPi3b Sodium/phosphate cotransporter 2B

UniProt

O95436

Expression Region

574-689aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 574-689aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDC1 (Phospho-Ser513) Antibody
orb191652-01 50 μL

MDC1 (Phospho-Ser513) Antibody

Sign In for Pricing
View Details
MDC1 (Phospho-Ser513) Antibody
orb191652-02 100 µL

MDC1 (Phospho-Ser513) Antibody

Sign In for Pricing
View Details
Rabbit Anti-Mcl-01/MCL1 Polyclonal Antibody
PAV8811 100 μL

Rabbit Anti-Mcl-01/MCL1 Polyclonal Antibody

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-4749-3p Vector
mh31735 500 ng

LentimiRa-Off-hsa-miR-4749-3p Vector

Sign In for Pricing
View Details
GEFT Rabbit Polyclonal Antibody (BF647)
orb2540338 100 µL

GEFT Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
SLIK5 Polyclonal Antibody
MBS8531466-01 0.1 mg

SLIK5 Polyclonal Antibody

Sign In for Pricing
View Details