Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine S100A9 protein

This Bovine S100A9 protein spans the amino acid sequence from region 2-156aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BEE22 Calgranulin-B Neutrophil cytosolic 23KDA protein

UniProt

P28783

Expression Region

2-156aa

Tag

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 2-156aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDKMSQMESSIETIINIFHQYSVRLGHYDTLIQKEFKQLVQKELPNFLKKQKKNEAAINEIMEDLDTNVDKQLSFEEFIMLVARLTVASHEEMHNTAPPGQGHRHGPGYGKGGSGSCSGQGSPDQGSHDLGSHGHGHGHSHGGHGHSHGGHGHSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD39 (ENTPD1) (NM_001164181) Human Over-expression Lysate
LY431349 100 µg

CD39 (ENTPD1) (NM_001164181) Human Over-expression Lysate

Sign In for Pricing
View Details
QuantiChrom™ α-L-Fucosidase Assay Kit
DFUC-100 100 Tests

QuantiChrom™ α-L-Fucosidase Assay Kit

Sign In for Pricing
View Details
Anti-Human IgM Antibody
KC-075-01 50 μL

Anti-Human IgM Antibody

Sign In for Pricing
View Details
Anti-Human IgM Antibody
KC-075-02 100 µL

Anti-Human IgM Antibody

Sign In for Pricing
View Details
Anti-Human IgM Antibody
KC-075-03 1 mL

Anti-Human IgM Antibody

Sign In for Pricing
View Details
IL1 Receptor II (IL1R2) (NM_004633) Human Recombinant Protein
TP321860 20 µg

IL1 Receptor II (IL1R2) (NM_004633) Human Recombinant Protein

Sign In for Pricing
View Details