Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine S100A9 protein

This Bovine S100A9 protein spans the amino acid sequence from region 2-156aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BEE22 Calgranulin-B Neutrophil cytosolic 23KDA protein

UniProt

P28783

Expression Region

2-156aa

Tag

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 2-156aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDKMSQMESSIETIINIFHQYSVRLGHYDTLIQKEFKQLVQKELPNFLKKQKKNEAAINEIMEDLDTNVDKQLSFEEFIMLVARLTVASHEEMHNTAPPGQGHRHGPGYGKGGSGSCSGQGSPDQGSHDLGSHGHGHGHSHGGHGHSHGGHGHSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FNDC5 Human Gene Knockout Kit (CRISPR)
KN212977 1 Kit

FNDC5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DEF6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F9]
TA505323BM 100 µL

DEF6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F9]

Sign In for Pricing
View Details
Nat8f1 Mouse Gene Knockout Kit (CRISPR)
KN503515 1 Kit

Nat8f1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTF1 Mouse Monoclonal Antibody [Clone ID: OTI1D3]
CF805437 100 µg

MTF1 Mouse Monoclonal Antibody [Clone ID: OTI1D3]

Sign In for Pricing
View Details
3-Bromo-4-isopropylbenzoic acid
TRC-B696488-250MG 250 mg

3-Bromo-4-isopropylbenzoic acid

Sign In for Pricing
View Details
MST1L Human qPCR Primer Pair (NR_002729)
HP220115 200 Reactions

MST1L Human qPCR Primer Pair (NR_002729)

Sign In for Pricing
View Details