Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Dermcidin protein

This Human Dermcidin protein spans the amino acid sequence from region 20-110aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Preproteolysin

UniProt

P81605

Expression Region

20-110aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 20-110aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
MBS1078243-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
MBS1078243-02 0.1 mg (E-Coli)

Recombinant Escherichia coli Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
MBS1078243-03 0.02 mg (Yeast)

Recombinant Escherichia coli Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
MBS1078243-04 0.1 mg (Yeast)

Recombinant Escherichia coli Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
MBS1078243-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
MBS1078243-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)

Sign In for Pricing
View Details