Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral ORF7 protein

This Viral ORF7 protein spans the amino acid sequence from region 1-123aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

V5N6H2

Expression Region

1-123aa

Tag

Tag-Free

Source

E.coli

Origin

Porcine reproductive and respiratory syndrome virus (PRRSV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 1-123aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPNNNGKQQKRKKGDGQPVNQLCQMLGKIITQQNQSRGKGPGKKNKKKNPEKPHFPLATEDDVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCTN2 Antibody
MBS150397-01 0.1 mg

TCTN2 Antibody

Sign In for Pricing
View Details
TCTN2 Antibody
MBS150397-02 5x 0.1 mg

TCTN2 Antibody

Sign In for Pricing
View Details
PKC epsilon/PRKCE Rabbit Polyclonal Antibody (Fluoro488)
orb3077954 100 µg

PKC epsilon/PRKCE Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Mouse Vesicle-trafficking protein SEC22a, Sec22a ELISA KIT
ELI-53030m 96 Tests

Mouse Vesicle-trafficking protein SEC22a, Sec22a ELISA KIT

Sign In for Pricing
View Details
EIF5A (Eukaryotic Translation Initiation Factor 5A-1, eIF-5A-1, eIF-5A1, Eukaryotic Initiation Factor 5A Isoform 1, eIF-5A, eIF-4D, Rev-binding Factor) (Biotin)
126252-Biotin 100 µL

EIF5A (Eukaryotic Translation Initiation Factor 5A-1, eIF-5A-1, eIF-5A1, Eukaryotic Initiation Factor 5A Isoform 1, eIF-5A, eIF-4D, Rev-binding Factor) (Biotin)

Sign In for Pricing
View Details
Canine Zona Pellucida Antibody ELISA Kit
MBS021651-01 48 Well

Canine Zona Pellucida Antibody ELISA Kit

Sign In for Pricing
View Details